black friday sale

Big christmas sale

Premium Access 35% OFF

Home Page
cover of Instantaneous Transportation
Instantaneous Transportation

Instantaneous Transportation

sonicfableforgesonicfableforge

0 followers

00:00-00:01

The audio titled "Instantaneous Transportation" starts with a captivating, futuristic sound. You can sense the science and power elements through a pulsating, electric hum that intensifies, mimicking the buildup of a teleportation device. The sound of laser beams firing forms a consistent rhythm, hinting at the high-tech, digital aspects of the audio. Midway through, there's a sudden pause followed by a dramatic sonic boom, perfectly encapsulating the instant transition of teleportation. The audio then transitions into a serene, celestial melody symbolizing the tranquil vastness of space. This soothing sequence is occasionally interrupted by sharp, electric sound effects, signifying the continuous use of electricity and its immense power in this futuristic setting. As the audio progresses, you can hear digital blips and beeps, reminiscent of a video game. This gives a nod to the game tag, suggesting the concept of teleportation isn't merely confined to reality, but is also a signific

Sound Effectsteleportlaserelectricpowerspaceelectricitysciencegamefuturedigital

Audio hosting, extended storage and much more

Listen Next

Other Creators